Catalog No.:AB0276-100
Price / Unit: EUR 320.00
Source: Goat
Quantity/unit size: 200 µg
Description: Goat polyclonal antibody to Chain A defensin ARD1. This peptide isolated from one-spotted leafwing butterfly and moth has been shown to have antimicrobial properties. Alternative names: Heliomycin, ETD135, ETD151 antibody.
Form: Polyclonal antibody supplied as a 100 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Immunogen: Purified recombinant defensin ARD1 from one-spotted prepona (MDKLIGSCVWGAVNYTSNCRAECKRRGYKGGHCGSFANVNCWCET) produced in E. coli.
Specificity: Using the recombinant ARD1 gives a positive signal by Western blot. Due to high homology it is likely to recognise heliomycin.
Reactivity: Reacts against peptides from Archeoprepona genus.
Usage: Western blot 1:500-1:2,000Immunofluorescence NDImmunohistochemistry (paraffin) NDImmunohistochemistry (frozen) ND
Reactivity chart
Sample | Western Blot | Immuno-fluorescence | Immuno-Histochemistry (p) | Immuno-Histochemistry (f) | Archeoprepona | +++ | ND | ND | ND |
Storage: Store at -20 C for long-term storage. Store at 2-8 C for up to one month.
Special instructions: Avoid freeze/thaw cycles.