Molecular Weight: 4540.34 Salt Form: TFA Purity: >95% Sequence (3-letter): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-NH2 Sequence (1-letter): YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGA(NH2) Storage: -20 °C or below
Growth Hormone Releasing Factor (GHRF) is a peptide that stimulates the release of growth hormone via GPCR receptor GHRH-R. N-terminal fragments and modified fragments are used to study the biological roles of GHRF.
Categories | Peptides |
---|
Filter | Metabolic / Diabetes, Neuropeptides & Hormones |
---|