CAS Number: 93755-85-2Molecular Weight: 2857.52Salt Form: TFAPurity: >96%Sequence (3-letter): Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2Sequence (1-letter): VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2Storage: -20 °C or below
Gastrin Releasing Peptide, human, is a ligand for the GRP receptor and is expressed in a subtype of peptidergic dorsal root ganglion neurons. GRP stimulates pepsinogen release and has also been identified as a tumor marker in the diagnosis of small-cell lung carcinoma. GRP is the mammalian analog of Bombesin.
Categories | Peptides |
---|
Filter | Gastrointestinal, Neuropeptides & Hormones |
---|