Molecular Weight: 3525.73Salt Form: TFAPurity: >96%Sequence (3-letter): Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr-Arg-Ser-Gln-Glu-Asp-Pro-Asn-Ala-Tyr-Tyr-Glu-Glu-Leu-Phe-Asp-Val-OHSequence (1-letter): YGGFLRRQFKVVTRSQEDPNAYYEELFDV-OHStorage: -20 °C or below
Leumorphin, porcine which corresponds to the 228-256 fragment of Preproenkephalin B. It is also known as Dynorphin B29 and Prodynorphin 228-256. Leumorphin is potent and selective κ-opioid receptor agonist. The porcine form of Leumorphin differs by 3 amino acids from the human form.
Categories | Peptides |
---|
Filter | Neuropeptides & Hormones |
---|